General Information

  • ID:  hor002356
  • Uniprot ID:  P15513
  • Protein name:  Myomodulin
  • Gene name:  MYOMOD1
  • Organism:  Aplysia californica (California sea hare)
  • Family:  Myomodulin family
  • Source:  Animal
  • Expression:  Expressed in all ganglia of the CNS, but only in a subset of neurons including L10 in the abdominal ganglion and B16 in the buccal ganglion.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Aplysia (genus), Aplysiidae (family), Aplysioidea (superfamily), Aplysiida (order), Tectipleura, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AMGMLRM
  • Length:  7
  • Propeptide:  MQVYMLLPLAVFASLTYQGACEETAAAQTSSDASTSSASSEHAENELSRAKRGSYRMMRLGRGLHMLRLGKRGGPVEPESEENLETLLNLLQGYYSDVPEYPSEFDDTDLAYPYEEYDAPAHPRYRRSTPPTDGVVAPDVLQKGSSEFEDFGDSQLDESDEGYYGYDPENYLYGDFEDYLEPEEGGLGEEKRSLSMLRLGKRGLSMLRLGKREGEEGDEMDKKQDESLNDDFENDDIKRTLSMLRLGKRPMSMLR
  • Signal peptide:  MQVYMLLPLAVFASLTYQ
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  The most potent contractile action on the esophagus
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P15513-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002356_AF2.pdbhor002356_ESM.pdb

Physical Information

Mass: 91628 Formula: C32H60N10O8S3
Absent amino acids: CDEFHIKNPQSTVWY Common amino acids: M
pI: 10.55 Basic residues: 1
Polar residues: 1 Hydrophobic residues: 2
Hydrophobicity: 91.43 Boman Index: -20
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 70
Instability Index: 3608.57 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  7765183
  • Title:  A myomodulin-CARP-related Peptide Isolated From a Polychaete Annelid, Perinereis Vancaurica